Sample 3300005076

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005076

3300005076: Combined Assembly of Gp0111534, Gp0111535, Gp0111536

Overview

Basic Information
IMG/M Taxon OID	3300005076 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114457 \| Gp0111534 \| Ga0069612
Sample Name	Combined Assembly of Gp0111534, Gp0111535, Gp0111536
Sequencing Status	Permanent Draft
Sequencing Center	University of Michigan
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	543798130
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa
Type	Engineered
Taxonomy	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor → Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	Ann Arbor, MI
Coordinates	Lat. (^o)	42.293023	Long. (^o)	-83.713393	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0069612_10123421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	839	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0069612_10123421	Ga0069612_101234211	F069722	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.