| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005061 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114530 | Gp0149122 | Ga0070921 |
| Sample Name | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 30 soap2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Center for Advanced Technologies in Genomics, Sao Paulo University |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 190791087 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sao Paulo Zoo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001417 | Metagenome / Metatranscriptome | 699 | Y |
| F012882 | Metagenome / Metatranscriptome | 276 | Y |
| F018520 | Metagenome | 234 | Y |
| F036812 | Metagenome / Metatranscriptome | 169 | Y |
| F101252 | Metagenome | 102 | Y |
| F102140 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0070921_1369690 | Not Available | 602 | Open in IMG/M |
| Ga0070921_1382215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| Ga0070921_1399197 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0070921_1348119 | Ga0070921_13481191 | F001417 | GCGATSPLFFLPVARAATLAGRPCEVQIVAMDGAQASAIHQALVSVQDAVTQMTFSSCDKDDVLELIERVENELHSPHPNLALMCTFLNSIARSLRAQPEAREACLAIEEAIEKAGMPSTWQSGI* |
| Ga0070921_1369690 | Ga0070921_13696902 | F012882 | ALRKATETSFYKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR* |
| Ga0070921_1382215 | Ga0070921_13822152 | F018520 | ACYANCDGSTTEPILNVNDFICFQTQFAAGSSYANCDNSTAEPVLNVNDFICFQSRFAAVCGLPCR* |
| Ga0070921_1392885 | Ga0070921_13928852 | F102140 | SWRRAEARHQHEYDCMENPRQEDFANAYYVHDRYRPTCMRVQGEGMEPSRMVCRREEQ* |
| Ga0070921_1397937 | Ga0070921_13979371 | F036812 | MAETPRRRLLDRMGSAPSFVTEGSRITGDVETSGPLIVCGTIRGDGH |
| Ga0070921_1399197 | Ga0070921_13991972 | F101252 | MHGLDALLSDLEWRRLRRRVSRHPAEAMFLNCWTWLRIMVLRSISR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |