NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004959

3300004959: Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL130115 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004959 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0092412 | Ga0031678
Sample NameMetatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL130115 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25147215
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1
Not Available1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBlanes Bay
CoordinatesLat. (o)41.67Long. (o)2.8Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009123Metagenome / Metatranscriptome322N
F009426Metagenome / Metatranscriptome318Y
F090441Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0031678_108831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella677Open in IMG/M
Ga0031678_109765Not Available602Open in IMG/M
Ga0031678_180790All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica837Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0031678_108831Ga0031678_1088312F009426TTAKVNKDLKLWSAMVRGETSYTIIIFMTTGPCVISAGAARETLFEGKADCCMLVCE*
Ga0031678_109765Ga0031678_1097651F090441KGEVWELATLSFLDSLALGALITRRVIIGCQFPDAASYRKNDCDTFRSHSGT*
Ga0031678_180790Ga0031678_1807901F009123SKLTMLSIVGLSATANNAEVTTSNLRSGAAFDNLKASWGKKLSLGDFSSQLDCSYDYNANRDFLKSASLSGNLVDGSGDDLSVGYEVTKNFAGDKTTEVKLTADMSGTRLTAEMDTADQLKEVSAARTVSIGDRDVDLEPSFLVKAQTARVKLMSAFGKDRASAQVDYKTEGGDISYELGYERDLQDGRQVSATLTPADKNLDVELVDTKFESGATWTAKASVPLEADNVLDAAKVTLKRAWNW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.