Basic Information | |
---|---|
IMG/M Taxon OID | 3300004959 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092412 | Ga0031678 |
Sample Name | Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL130115 (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 25147215 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Blanes Bay | |||||||
Coordinates | Lat. (o) | 41.67 | Long. (o) | 2.8 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009123 | Metagenome / Metatranscriptome | 322 | N |
F009426 | Metagenome / Metatranscriptome | 318 | Y |
F090441 | Metatranscriptome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0031678_108831 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 677 | Open in IMG/M |
Ga0031678_109765 | Not Available | 602 | Open in IMG/M |
Ga0031678_180790 | All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | 837 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0031678_108831 | Ga0031678_1088312 | F009426 | TTAKVNKDLKLWSAMVRGETSYTIIIFMTTGPCVISAGAARETLFEGKADCCMLVCE* |
Ga0031678_109765 | Ga0031678_1097651 | F090441 | KGEVWELATLSFLDSLALGALITRRVIIGCQFPDAASYRKNDCDTFRSHSGT* |
Ga0031678_180790 | Ga0031678_1807901 | F009123 | SKLTMLSIVGLSATANNAEVTTSNLRSGAAFDNLKASWGKKLSLGDFSSQLDCSYDYNANRDFLKSASLSGNLVDGSGDDLSVGYEVTKNFAGDKTTEVKLTADMSGTRLTAEMDTADQLKEVSAARTVSIGDRDVDLEPSFLVKAQTARVKLMSAFGKDRASAQVDYKTEGGDISYELGYERDLQDGRQVSATLTPADKNLDVELVDTKFESGATWTAKASVPLEADNVLDAAKVTLKRAWNW* |
⦗Top⦘ |