NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004957

3300004957: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_10m_RNA (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004957 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0111057 | Ga0066624
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_10m_RNA (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size14231436
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal inletsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaanich Inlet, Vancouver Island, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009123Metagenome / Metatranscriptome322N
F080882Metagenome / Metatranscriptome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066624_145213All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica754Open in IMG/M
Ga0066624_147095Not Available640Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066624_145213Ga0066624_1452131F009123TSNLRSGASFDNLKASWGKALSLGDFKTQLDCSYDYNGNKEFIKDAKLSGSLIDGSGDDLSLGYEVTKNFGGDKTTEVTLTAEVSGTTVSAELDTADNLKEVGASRSVTIGDRDVTVSPSFLVKAQTARVKLMTALGKDNLSVQADIDGTDLSAIEVEYERDLEDGRTLTASLTPADKNLEVEVTDTKFESGATWTAKATVPLEGDNMVDDAKLTLTRAWSW*
Ga0066624_147095Ga0066624_1470952F080882TTGSTFNSYEDVYLLGGTSHCGSWFGGLYHGRPFIGTQCNWGSSTAVGVDQTTATVALQANQTYRIQWMYNVAEGYRRAQIKVDGVVVVDSTTAYLNVDSSSTEEFLSIGSGYHTQVSETLQGSVKKVSVHICGENI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.