Sample 3300004930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300004930

3300004930: Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e

Overview

Basic Information
IMG/M Taxon OID	3300004930 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114547 \| Gp0113131 \| Ga0070794
Sample Name	Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e
Sequencing Status	Permanent Draft
Sequencing Center	Heinrich Heine University of Dusseldorf
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	142826939
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Simulated Microbial Communities From King Abdullah University Of Science And Technology
Type	Engineered
Taxonomy	Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From King Abdullah University Of Science And Technology

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	na → na → na

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0070794_102360	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	8214	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0070794_102360	Ga0070794_1023602	F010244	VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.