Sample 3300004881

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300004881

3300004881: Ecklonia radiata associated microbial communities from Long Bay, Malabar Australia B3

Overview

Basic Information
IMG/M Taxon OID	3300004881 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114398 \| Gp0111410 \| Ga0068280
Sample Name	Ecklonia radiata associated microbial communities from Long Bay, Malabar Australia B3
Sequencing Status	Permanent Draft
Sequencing Center	University of New South Wales
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	40261599
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Ecklonia Radiata Associated Microbial Communities From Long Bay, Malabar Australia
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Ecklonia Radiata Associated → Ecklonia Radiata Associated Microbial Communities From Long Bay, Malabar Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant corpus

Location Information
Location	Long Bay, Malabar, NSW 2036
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056035	Metagenome / Metatranscriptome	138	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0068280_100001	Not Available	91824	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068280_100001	Ga0068280_10000170	F056035	MSLLYKDPKDVKITCHIKQEEGKIILGFTADCGKFGTEETLDHYVLTPKRLIQILQDRDDYTEKEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.