| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004755 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114441 | Gp0111473 | Ga0068403 |
| Sample Name | Marine sediment microbial communities from Formosa Ridge, South China Sea - G1-2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2776003 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South China Sea, southwestern Taiwan | |||||||
| Coordinates | Lat. (o) | 22.11546667 | Long. (o) | 119.28443333 | Alt. (m) | N/A | Depth (m) | 1146 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056621 | Metagenome | 137 | Y |
| F076930 | Metagenome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0068403_14201 | Not Available | 923 | Open in IMG/M |
| Ga0068403_15455 | Not Available | 623 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0068403_14201 | Ga0068403_142011 | F056621 | LNDKERATLAERIQKTVQEKHPHYQITKRKDEIEKEFEVKNENRRF* |
| Ga0068403_15455 | Ga0068403_154551 | F076930 | MTEHKYIELTKRAFDLGFRQGYEIANRTLIDENTGKDEFANIVLETAINSLESTVFESIAAELDLMNEKYPAFDSWKVFSDGVIHGAGENFLDRTGNEE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |