NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004625

3300004625: Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2



Overview

Basic Information
IMG/M Taxon OID3300004625 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053073 | Gp0101316 | Ga0055543
Sample NameArabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size199299933
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
TypeHost-Associated
TaxonomyHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUSA: North Carolina
CoordinatesLat. (o)35.6667Long. (o)-78.5097Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019507Metagenome / Metatranscriptome229Y
F042047Metagenome / Metatranscriptome159Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0055543_1001633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8552Open in IMG/M
Ga0055543_1011092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter1861Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0055543_1001633Ga0055543_10016331F042047MPSAKQCRAFAAEYKKLAIDPNNSARRSSVLKSISNSWTALGHQLESLAMVAKEEQR*
Ga0055543_1011092Ga0055543_10110921F019507MDARELVDIACEDDPRAPCLWLPSDLFPEFCEAIRQRPNLIGAVIYRNKTIRDGGPYSDITTRRP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.