NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004588

3300004588: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 13_LOW5 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004588 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111161 | Ga0066497
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 13_LOW5 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size48958626
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei3
Not Available2
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001346Metagenome / Metatranscriptome718Y
F001633Metagenome / Metatranscriptome660Y
F002020Metagenome / Metatranscriptome603Y
F010923Metagenome / Metatranscriptome297Y
F044534Metagenome / Metatranscriptome154Y
F053640Metagenome / Metatranscriptome141Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066497_1002964All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila710Open in IMG/M
Ga0066497_1006819All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei546Open in IMG/M
Ga0066497_1008098Not Available619Open in IMG/M
Ga0066497_1028672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei698Open in IMG/M
Ga0066497_1029254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei698Open in IMG/M
Ga0066497_1089425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4548Open in IMG/M
Ga0066497_1116597Not Available644Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066497_1002964Ga0066497_10029642F053640ESTAGIIPGDRGMVGDNWCRPPLQAAKVVERHISPVPLAGVVSGQYTHEVGTERRGAIRNRVEPSQVHGAFRPVRRRSYPRGFWLLLRRPERSHGFRRANPAKRPRSQHERGAQGNRDGGEGAGLAKPVKPPQWGGAKNRVTPLQKRKQP*
Ga0066497_1006819Ga0066497_10068191F001633LAFAGGVLPDATLRGMRMSRSHGGTVLTVAGRDLSSEASAPGSEIPCREDHAGRGADTPAIFIVSRPHPYHGDGTGFWPVVGPALRV*
Ga0066497_1008098Ga0066497_10080981F001346VKTFQAVGDAKNGTADLWTKRNLRVKRRDPWHRANALSKAAADPALSGEDADQKTQTCLDLVRKPVAQPPAQAC*
Ga0066497_1028672Ga0066497_10286721F001633VLPDATLRGMRMFRSHGGTVLTVAGRDLSSEASAPGSATPCRERHARRGADTPAIFIVSRLHRYHGDGTSFWLAVGPALRV*
Ga0066497_1028672Ga0066497_10286722F044534NPGRPGNGWWQLVPPSPPNRVSGMAGIYHQFLWPESCPVSSHTNQELSREARLETAPNGVRPTGRFDPCADAVTPEGFGCYCADQNAVAISGGTTPPKGPARSTSRARKEVTTAGSERT*
Ga0066497_1029254Ga0066497_10292541F001633VLPDATLRGMRMFRSHGGTVLTVAGRDLSSEASAPGSDAPCRERHAGRGADTPATFIFSRLHRYHGDGTSLWLAVGPALRV*
Ga0066497_1089425Ga0066497_10894251F002020TGMHGIEHCEQKRRTICLSAPRWPFSPAAGSMLPDSPLAAFCPEPVARNGLSLTHNGCHLSAASIPGSKLPACYFASSQVASVPVRPFGSTTANSGLRRFAAASLPVARCTSTSWFGLPRPPSPLPSGTFASLGIKAFNGVCCLPVHLTNSPDFLSLPAARSNESWGVGSSFQVRYVSAGLL
Ga0066497_1116597Ga0066497_11165972F010923DPQPQLSSGRAAGSERKSGGFVRWTGRQQTRLNTLIPRDVKVPEGSGDGRRGRPNRVVEVQRARGSETAATGANRDAVVEPKGRTGTEANLEGSEVAGWEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.