NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004570

3300004570: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 7_HOW4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004570 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114290 | Gp0111157 | Ga0066493
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 7_HOW4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21337526
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila2
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001633Metagenome / Metatranscriptome660Y
F011719Metagenome / Metatranscriptome288Y
F041780Metagenome / Metatranscriptome159Y
F046210Metagenome / Metatranscriptome151N
F082737Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066493_100800All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila747Open in IMG/M
Ga0066493_103579Not Available558Open in IMG/M
Ga0066493_103778All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila645Open in IMG/M
Ga0066493_111798Not Available593Open in IMG/M
Ga0066493_153599Not Available536Open in IMG/M
Ga0066493_154596Not Available743Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066493_100800Ga0066493_1008002F001633ALAFAGGVLPDATLRGMRMFRSHGGTVLTVAGRDFSSEASSPGSDAPCRERRAGRGADTPAIFIVSRRHLYHGDGTSFWPVVGPALRV*
Ga0066493_103579Ga0066493_1035791F082737MLGGPPASLPVRSQNFETDFHSPSKTNLLPDRRGGVRVPALPLQLCGTLAVSPVRSDLHPRPVSRTAWDFYDQNPLLPDPAPLLPASLNRRSPLGFFAPPDQSARSRWPTGNLLSATPDLPSLPTGGRIRYQHQRIIVPAPLRLCQLAV
Ga0066493_103778Ga0066493_1037781F001633ALAFAGGVLPDATLRGMRMFRSHGGTVLTVTGRDLLSEASSPGSDAPCRERRAGRGADTPAIFIVSRLHPYHGDGTSFWPAVGPALRV*
Ga0066493_111798Ga0066493_1117981F046210NIQMKNLKIEAEKGFRRTLFEPELVDPNLEINFVNDAEAAVKCRNVNS*
Ga0066493_113814Ga0066493_1138142F001633FATRSFPVAHEGALAFAGCVLPDATLRGRRMFRSHGGTVLTVAGRDLLSEASSPSSVAPAGSGTPDVVRTRLQSYFASARYHGDGASLWLAVGPALRV*
Ga0066493_153599Ga0066493_1535991F041780ACSPTGMHGQNTAF*MTGLNSLCSPRPPFGGSASTLWAQPARHSNRNRNLETAFLLTCGDFPYPELRDKLKRSQPASSISLPCPIRIRSVLNSLPDAFGFRRGHGHKTRFPLAARQSRPILEPPLPFRVSPPPDHNAQSDSDREVYLGKTPDIPLLPERINE*
Ga0066493_154596Ga0066493_1545961F011719IIPGDWGKAGSGWLAQPLLSRIARFGSGGRIHQSLWQRSRAVSVREKGTERRGAIRNRCKPSQVVQAGFEPGRIAVTQRVSGCYCASARAGGSGGLRKEVCQMKDAERRDKVSARTGKDTRPRQDP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.