NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004569

3300004569: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 34_HOW6 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004569 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111176 | Ga0066512
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 34_HOW6 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22472380
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001904Metagenome / Metatranscriptome619Y
F034014Metagenome / Metatranscriptome175Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066512_136667All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii647Open in IMG/M
Ga0066512_138072Not Available546Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066512_136667Ga0066512_1366671F001904LLPVTMRSTLLIVLLAALAMAVVAETDFMSAVAEAGGDCHPECRWQCDDPVCPAVCHPVCERPKCQIHCEETECAKCKIHCDKPQCNVRCPKDLCEKKDCPKCETVCSPANCRTQCDAPNAVCTPMCEATKCDWKCKKPITCPKPKCELVCERPACDTRSRKSGTKPGCCSCADQANLAATIRAANALVEESSEMSAMMPSFMEVMHSIKAKEQG
Ga0066512_138072Ga0066512_1380721F034014VSGTVNPFLADKGAALLRPVLNVVFKPVTDAFIHAVKGFHSHMAAKISSNEFAAARFQATLDYSDWQMDWWSGPIHQGYVIVHRMYADDFATIASLLVGGITPYTVYNMVCDKLKMLVHRAVFTFGSLAKSIAESELASVLSHVTSLLFHDVKVCVQSVISEVLAAILSAPLQEMVLKPCGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.