NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004566

3300004566: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 19_HOW5 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004566 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111165 | Ga0066501
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 19_HOW5 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17076163
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037503Metagenome / Metatranscriptome168Y
F066797Metagenome / Metatranscriptome126Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066501_104180All Organisms → cellular organisms → Bacteria1719Open in IMG/M
Ga0066501_135695All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines880Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066501_104180Ga0066501_1041801F037503MFLGTASRLSVIEVELLIGLGGFTAYQILTNSEYYNIYSGVSPWVLRSVGERERTQTNS*
Ga0066501_135695Ga0066501_1356951F066797SSADLGGSSNYSKKTIYSWLTLKTEVAKVFMTTEIAHELVDPNPKDYEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.