NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004564

3300004564: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 8_HOW4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004564 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111158 | Ga0066494
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 8_HOW4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12911536
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001418Metagenome / Metatranscriptome698Y
F002020Metagenome / Metatranscriptome603Y
F041780Metagenome / Metatranscriptome159Y
F046210Metagenome / Metatranscriptome151N
F102642Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066494_110461Not Available652Open in IMG/M
Ga0066494_126047Not Available538Open in IMG/M
Ga0066494_129717Not Available532Open in IMG/M
Ga0066494_130485Not Available718Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066494_110461Ga0066494_1104611F046210MKNLKIEAEKGFRRTFFEPELVDPNLEINFVNDAEAAVKCRNVNS*
Ga0066494_126047Ga0066494_1260471F041780VAACSPTGIHGQNMALKVTGSLSRCSPRPPFGGSASTLWAQPANHPNRNRNLETAFLLP*GDSPYPELRDRLERSQPASSISLPCSIQVRSALNSLPDAFGLRRGHGHKTRFPLVTRQSRPILKPPLPLRVSSPPDHSAQSDSDREVYLDRMPDISSLPERNISTSRSTFRARYILSGF
Ga0066494_129060Ga0066494_1290601F102642LLLRTSTERVTLAVFGNEGLLNERRRKAGQREHSIREGHDASAGRVKTFRRAGDVEKGTAGL*
Ga0066494_129717Ga0066494_1297171F002020EHREQKRRTIRLSAPRWPFSPAYGSVLPGSPLAASCPEPAARNGFSLARNSCRLSATSIPGSKLPACYFASFQIGFRARSALRLHYRIPRFAPVAAASLPLARCTSTTRFGLPRLRSPLPSGTFTSLGIKAFNRVCCLPVHLANPPDFLSLPATRPN*
Ga0066494_130485Ga0066494_1304851F001418LELEAGFTSSSGSVRALSVNAKKELGDEVRLETAPNRVK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.