NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004526

3300004526: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 116_HOW13 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004526 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111230 | Ga0066566
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 116_HOW13 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21297317
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061214Metagenome / Metatranscriptome132Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066566_103901All Organisms → cellular organisms → Eukaryota → Opisthokonta3421Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066566_103901Ga0066566_1039012F061214LSVISALCRLVNGFAEITICLALKETPINGGLTYEGPKVAEYLGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.