| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004523 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111173 | Ga0066509 |
| Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 31_HOW6 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 14934628 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Lake Washington, Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046210 | Metagenome / Metatranscriptome | 151 | N |
| F066797 | Metagenome / Metatranscriptome | 126 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0066509_106707 | All Organisms → cellular organisms → Eukaryota | 1030 | Open in IMG/M |
| Ga0066509_107372 | Not Available | 543 | Open in IMG/M |
| Ga0066509_133171 | Not Available | 1361 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066509_106707 | Ga0066509_1067071 | F046210 | LVIVANIQMKNLKIEAEKGFRRTLFEPELVDPNLEINFVNDAEAAVKCRNVNS* |
| Ga0066509_107372 | Ga0066509_1073721 | F046210 | LVIVANIQMKNLKIEAEKGFRRTLFEPELVDPNLEINFVNDAEAALKSCNVNS* |
| Ga0066509_133171 | Ga0066509_1331712 | F066797 | VQGLNLHQIISSADLGGSSNYSKETLLKRLTLKTEVAKVFMTTAIAHELVDPNPKDYEK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |