| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004257 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111134 | Ga0066470 |
| Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 104_HOW12 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 103844936 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Cephalotes Ants Gut Microbiomes |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Lake Washington, Seattle, Washington | |||||||
| Coordinates | Lat. (o) | -19.11 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105273 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066470_1024231 | Ga0066470_10242312 | F105273 | MLVTAGFFSSGQSSTDSVYTGTLDSGKAKVVIDRETKGLNKAGLAKAIRTGTIYNSTSPYHNDLHEFTYWV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |