NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004257

3300004257: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 104_HOW12



Overview

Basic Information
IMG/M Taxon OID3300004257 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111134 | Ga0066470
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 104_HOW12
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size103844936
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCephalotes Ants Gut Microbiomes
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)-19.11Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105273Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066470_1024231Ga0066470_10242312F105273MLVTAGFFSSGQSSTDSVYTGTLDSGKAKVVIDRETKGLNKAGLAKAIRTGTIYNSTSPYHNDLHEFTYWV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.