NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003965

3300003965: Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39870



Overview

Basic Information
IMG/M Taxon OID3300003965 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0113966 | Gp0109833 | Ga0063600
Sample NameEnrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39870
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size41731246
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHarmful Algal Blooms In Lake Erie
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomeglacial lakemicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLake Fryxell, Antarctica
CoordinatesLat. (o)-77.611214Long. (o)163.119356Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069970Metagenome123Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063600_100004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1517647Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063600_100004Ga0063600_10000483F069970MTTQFSKSIKVGDKVTFDNDQIEVFKAETSSTDKAVRQYQQLVLGGIDQVGVVKELGGNLTTVSYPDGWDLPVPTKYLIVLPSE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.