Basic Information | |
---|---|
IMG/M Taxon OID | 3300003965 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113966 | Gp0109833 | Ga0063600 |
Sample Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39870 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Michigan |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 41731246 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Harmful Algal Blooms In Lake Erie |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → glacial lake → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Lake Fryxell, Antarctica | |||||||
Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069970 | Metagenome | 123 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0063600_100004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1517647 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0063600_100004 | Ga0063600_10000483 | F069970 | MTTQFSKSIKVGDKVTFDNDQIEVFKAETSSTDKAVRQYQQLVLGGIDQVGVVKELGGNLTTVSYPDGWDLPVPTKYLIVLPSE* |
⦗Top⦘ |