


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003888 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113782 | Gp0109336 | Ga0062442 |
| Sample Name | Freshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Wisconsin, Madison |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 193262053 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 9 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → pond → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Middleton, WI | |||||||
| Coordinates | Lat. (o) | 43.0603 | Long. (o) | -89.5717 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026006 | Metagenome / Metatranscriptome | 199 | Y |
| F085790 | Metagenome / Metatranscriptome | 111 | Y |
| F096266 | Metagenome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0062442_1002988 | All Organisms → cellular organisms → Bacteria | 9543 | Open in IMG/M |
| Ga0062442_1003014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 43197 | Open in IMG/M |
| Ga0062442_1006455 | Not Available | 10327 | Open in IMG/M |
| Ga0062442_1008533 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| Ga0062442_1011422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3309 | Open in IMG/M |
| Ga0062442_1032855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 728 | Open in IMG/M |
| Ga0062442_1035992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 626 | Open in IMG/M |
| Ga0062442_1080039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 524 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0062442_1002988 | Ga0062442_10029882 | F085790 | MIDIFSHLPTRPNPALKSDPACIASRSLSSFRYLGSAHRLGAGVAA* |
| Ga0062442_1003014 | Ga0062442_10030148 | F026006 | MLAYMKKLSTLFVTLSLVLLPVFVSQAAAASIDVPMTTLTISKLGDLTLVVKDGVPQTIVVRGRDVGGSNVSFSINGIPYMGDVSLSNNLTLQPGTMPLMFDHYGKLCFTVGGNVLVLEYNGTAKKTVDTMALTKTLYSKGDFTVADGTGPFAGLKGMKGTYTLTEVCHIVAGEHPKVGSPVEFTFSGM* |
| Ga0062442_1006455 | Ga0062442_10064556 | F085790 | MREPPNPRLNSDPTCIAFRSLSTFCYLGFVQRLGAGGAG* |
| Ga0062442_1008533 | Ga0062442_10085331 | F085790 | MRKSLLANLSLKSDPACIAFRSLSAFSYLGSARHLGAGVAA* |
| Ga0062442_1008533 | Ga0062442_10085337 | F085790 | MVPGLPNPPLKSDPACIALRSLSAFRYHGSAHRLGAGVAA* |
| Ga0062442_1011422 | Ga0062442_10114227 | F085790 | MEWTLAQSRLPNPPLKSDPACIAFRSLSTSRYPGSAHRLGAGVAA* |
| Ga0062442_1032855 | Ga0062442_10328552 | F085790 | VPNPALHSDPACIAFRSLSTSRFLGFARRLGAGVAGELHSLG |
| Ga0062442_1035992 | Ga0062442_10359921 | F096266 | MIDARLIFLLLTTLLLAILSAIAVVTLRKNRKHKLEEPKYRMLKDD* |
| Ga0062442_1080039 | Ga0062442_10800393 | F085790 | MNHRLPNLPLNSDPACIAFRSLSASRFLGFARRLGAGGAG |
| ⦗Top⦘ |