NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003888

3300003888: Freshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2



Overview

Basic Information
IMG/M Taxon OID3300003888 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0113782 | Gp0109336 | Ga0062442
Sample NameFreshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Wisconsin, Madison
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size193262053
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG102
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → pond → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationMiddleton, WI
CoordinatesLat. (o)43.0603Long. (o)-89.5717Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026006Metagenome / Metatranscriptome199Y
F085790Metagenome / Metatranscriptome111Y
F096266Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062442_1002988All Organisms → cellular organisms → Bacteria9543Open in IMG/M
Ga0062442_1003014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria43197Open in IMG/M
Ga0062442_1006455Not Available10327Open in IMG/M
Ga0062442_1008533All Organisms → cellular organisms → Bacteria6904Open in IMG/M
Ga0062442_1011422All Organisms → cellular organisms → Bacteria → Proteobacteria3309Open in IMG/M
Ga0062442_1032855All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10728Open in IMG/M
Ga0062442_1035992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter626Open in IMG/M
Ga0062442_1080039All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10524Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062442_1002988Ga0062442_10029882F085790MIDIFSHLPTRPNPALKSDPACIASRSLSSFRYLGSAHRLGAGVAA*
Ga0062442_1003014Ga0062442_10030148F026006MLAYMKKLSTLFVTLSLVLLPVFVSQAAAASIDVPMTTLTISKLGDLTLVVKDGVPQTIVVRGRDVGGSNVSFSINGIPYMGDVSLSNNLTLQPGTMPLMFDHYGKLCFTVGGNVLVLEYNGTAKKTVDTMALTKTLYSKGDFTVADGTGPFAGLKGMKGTYTLTEVCHIVAGEHPKVGSPVEFTFSGM*
Ga0062442_1006455Ga0062442_10064556F085790MREPPNPRLNSDPTCIAFRSLSTFCYLGFVQRLGAGGAG*
Ga0062442_1008533Ga0062442_10085331F085790MRKSLLANLSLKSDPACIAFRSLSAFSYLGSARHLGAGVAA*
Ga0062442_1008533Ga0062442_10085337F085790MVPGLPNPPLKSDPACIALRSLSAFRYHGSAHRLGAGVAA*
Ga0062442_1011422Ga0062442_10114227F085790MEWTLAQSRLPNPPLKSDPACIAFRSLSTSRYPGSAHRLGAGVAA*
Ga0062442_1032855Ga0062442_10328552F085790VPNPALHSDPACIAFRSLSTSRFLGFARRLGAGVAGELHSLG
Ga0062442_1035992Ga0062442_10359921F096266MIDARLIFLLLTTLLLAILSAIAVVTLRKNRKHKLEEPKYRMLKDD*
Ga0062442_1080039Ga0062442_10800393F085790MNHRLPNLPLNSDPACIAFRSLSASRFLGFARRLGAGGAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.