NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003879

3300003879: Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0107_20120607_metagen



Overview

Basic Information
IMG/M Taxon OID3300003879 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0113941 | Gp0109644 | Ga0063279
Sample NamePlastic marine debris microbial communities from the Atlantic Ocean - SEA_0107_20120607_metagen
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size253664549
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlastic Marine Debris Microbial Communities From The Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodymanufactured plastic
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)35.55167Long. (o)-65.65833Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002374Metagenome / Metatranscriptome566Y
F013306Metagenome / Metatranscriptome272Y
F034767Metagenome / Metatranscriptome174Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063279_1002680Not Available7312Open in IMG/M
Ga0063279_1122105Not Available738Open in IMG/M
Ga0063279_1232660All Organisms → Viruses → unclassified viruses → Circular genetic element sp.649Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063279_1002680Ga0063279_100268011F034767MVFGSKIATATYDILRGVNATVWGGVEGAEKAGKIVKTGISGADVVIGTSHALEDFGCNDVVCGTIDVVGSVSSAVGLVLGNIPVTKHLTFITGSVTVGCRSVRYYCKKYGTFWGCTVAAGQGVKEAIKFTVKQ*
Ga0063279_1122105Ga0063279_11221051F013306AVTFGEAPPNGSLHYIQVNIIDREGDVIVDELGETGVPFDPDGPLDAQLGRIDNAGNGAGNGNLNIPGFDFQFSVPSGAAGGQANVNVAHVFNIAGSEVIELADGTPAVRTVVNWVVAAPFVGSALDEQFVTHTVTVTDAKGNTGMATGTFQLTDVVANGQLLTPQP*
Ga0063279_1232660Ga0063279_12326601F002374MHQVLLYLSLILASVAFFLCCYACARVGKLLNSVKGLDWDTVATLTGDIGTIKKSIQTLNNRINGLNSPKLNNELLLHALKEQSSNIHDIKKNNGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.