| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003874 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113835 | Gp0109374 | Ga0062457 |
| Sample Name | Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 84473367 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Isolated Sinkhole Microbial Communities From Lake Huron, Mi |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat → Isolated Sinkhole Microbial Communities From Lake Huron, Mi |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → sinkhole → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Huron, Mi | |||||||
| Coordinates | Lat. (o) | 45.2166667 | Long. (o) | -83.15 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000211 | Metagenome / Metatranscriptome | 1583 | Y |
| F018020 | Metagenome / Metatranscriptome | 237 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0062457_1034209 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 597 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0062457_1034209 | Ga0062457_10342092 | F018020 | DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE* |
| Ga0062457_1040197 | Ga0062457_10401971 | F000211 | MSYIYKVFEHLEQLWMGIWQPTHTVTTTEVSPDLGELAEILDDVSVEMIPLRYR* |
| Ga0062457_1040197 | Ga0062457_10401972 | F000211 | MSYIYKVFEHLKQLWMGIWQHIHTATTTEVSPDLGEFADILDDVSVEMIPLRYR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |