Sample 3300003871

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003871

3300003871: Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0136_20120610_metagen

Overview

Basic Information
IMG/M Taxon OID	3300003871 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0113941 \| Gp0109646 \| Ga0063281
Sample Name	Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0136_20120610_metagen
Sequencing Status	Permanent Draft
Sequencing Center	Marine Biological Laboratory
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	67667520
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Plastic Marine Debris Microbial Communities From The Atlantic Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → manufactured plastic
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Atlantic Ocean
Coordinates	Lat. (^o)	39.14333	Long. (^o)	-67.825	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000352	Metagenome / Metatranscriptome	1247	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0063281_1022070	Not Available	873	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063281_1022070	Ga0063281_10220704	F000352	MQNNMKTLKLTENDCIFVHYVLRMYAQQTPGLDQEDKNEIREVAAKFK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.