| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003868 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0085322 | Gp0089178 | Ga0062456 |
| Sample Name | Alpena Fountain idba assembled |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 45207620 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Fountain Water Microbial Communities From Alpena County Library, Michigan, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Fountain Water → Fountain Water Microbial Communities From Alpena County Library, Michigan, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → fountain → fresh water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alpena Town, Michigan | |||||||
| Coordinates | Lat. (o) | 45.062461 | Long. (o) | -83.431242 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0062456_1008362 | Not Available | 964 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0062456_1008362 | Ga0062456_10083622 | F050966 | MRENLMSGSRWQGMKTRHGDGTEALSQEMESNGSATPKSRRHPLTLPADVWDSARFTSIF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |