Sample 3300003838

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003838

3300003838: Agave microbial communities from Guanajuato, Mexico - At.P.rz

Overview

Basic Information
IMG/M Taxon OID	3300003838 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053055 \| Gp0104143 \| Ga0058691
Sample Name	Agave microbial communities from Guanajuato, Mexico - At.P.rz
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	253365543
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Beephvirinae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Agave Microbial Communities From California, Usa, And Mexico
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface

Location Information
Location	Guanajuato, Mexico
Coordinates	Lat. (^o)	20.6863	Long. (^o)	-101.8747	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077883	Metagenome	117	Y
F097652	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0058691_1000369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Beephvirinae	33277	Open in IMG/M
Ga0058691_1093834	Not Available	549	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0058691_1000369	Ga0058691_100036925	F097652	MANWVFITPTVDEAPFAWSPLMERFRLTRGVSVVEVSPGQYETTRYDAYTNELGAENLPQNPNQDTEFWPAERAGLHYFRGGYEWIVDDQIRSDIIASGAATAANFTPV*
Ga0058691_1093834	Ga0058691_10938341	F077883	LKLYFNPCIYNSMSFVIIKKGEIVGPKALHPSFDDDQLM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.