NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003778

3300003778: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_9/17/2007_ DNA



Overview

Basic Information
IMG/M Taxon OID3300003778 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103134 | Ga0056904
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_9/17/2007_ DNA
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size174133850
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001089Metagenome / Metatranscriptome781Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0056904_1050768All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae519Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0056904_1050768Ga0056904_10507681F001089SDPAADPASLPISCDCATDQAAIVTSAESDYLFRLAALSLTFVGFSSVVVTLQGRLGGELSDRHLRLVRLYIEGGFLVTALALVPTLLTFVQVPDRFVWPLSSAAAGAIFTLVLLIQFRRRRQVEPGRFPAWVIVIYVLSVAVVGALWLNVVGVPSPSRAGPYAVALTWALG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.