NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003771

3300003771: Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2



Overview

Basic Information
IMG/M Taxon OID3300003771 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053073 | Gp0101299 | Ga0055526
Sample NameArabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size287469528
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
TypeHost-Associated
TaxonomyHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUSA: North Carolina
CoordinatesLat. (o)35.6667Long. (o)-78.5097Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013935Metagenome / Metatranscriptome267Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0055526_1069076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0055526_1069076Ga0055526_10690761F013935LDLADARQRVLKRGSLLHQLLGLLGIVPEVGIFCELVQLGEACRRFLDVKDASSAARLTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.