| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003764 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055735 | Gp0103140 | Ga0056910 |
| Sample Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/23/2012_ DNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 141939480 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 6 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.076217 | Long. (o) | -89.411742 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054825 | Metagenome | 139 | Y |
| F069722 | Metagenome / Metatranscriptome | 123 | Y |
| F097376 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0056910_1000329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 46586 | Open in IMG/M |
| Ga0056910_1001061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16308 | Open in IMG/M |
| Ga0056910_1006079 | Not Available | 2298 | Open in IMG/M |
| Ga0056910_1007557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1894 | Open in IMG/M |
| Ga0056910_1023945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae | 786 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0056910_1000329 | Ga0056910_100032914 | F097376 | MKKAVTPKNNKTADDVVTQKKQENKSGPVELNLEELKKVSGGLPKGGWRVK* |
| Ga0056910_1001061 | Ga0056910_10010614 | F054825 | MGRSGPGLTPTPTPERTPHVSTHPATRNLDLWLIDKDDPGVTKPGPGVVYDRAGIGIVFMDERGRDFTFIDTGCALEAWAGQGARLSPALARDLAAALERFADYADGHTAYLLTEADDA* |
| Ga0056910_1006079 | Ga0056910_10060792 | F069722 | MRVRLTAELDPKAKRRRPDLDKGAAHQKALGHESGAVLRE* |
| Ga0056910_1006079 | Ga0056910_10060793 | F069722 | MRVRLTAELDPKAKRERPALKKGAAHEKPLGHESGAALQEG* |
| Ga0056910_1007557 | Ga0056910_10075573 | F069722 | RMRVRLTAELDPKAKRRRPDLDKGAAHEKALGHGSGAALQK* |
| Ga0056910_1023945 | Ga0056910_10239452 | F069722 | MRVRLTAKLDPKAKRKRPDLDKGAAHEKALGHGSGAVLQE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |