NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003750

3300003750: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA



Overview

Basic Information
IMG/M Taxon OID3300003750 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103133 | Ga0056903
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size131716788
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054825Metagenome139Y
F091594Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0056903_1000011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia166962Open in IMG/M
Ga0056903_1000298All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae26012Open in IMG/M
Ga0056903_1004010All Organisms → Viruses → Predicted Viral3034Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0056903_1000011Ga0056903_100001173F054825MSSQPTTRDLDLWLIDKDAEGVIKPGPGVVYDRAGIGIVFMDERGRDFTFIDVGTALEAWAGQGARLSPALARDLARALERFADYTDGHTAYVRVETADP*
Ga0056903_1000298Ga0056903_100029811F091594MSENGITHYCLGNGAPKCDGCKQEKNWQALNQMPGTLRKPLQAQAQRIDDTDCILSGRPWYVGA*
Ga0056903_1004010Ga0056903_10040103F091594MSEQAIKTFCLGNGEIGCDGCGQEKNWQTLNQMPNTLRLAMQDRAKRIDDSECIFRGRLWRT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.