Basic Information | |
---|---|
IMG/M Taxon OID | 3300003642 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047180 | Gp0107757 | Ga0061058 |
Sample Name | Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 03 (ZC4-mRNA-DAY-03) |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Sao Paulo, Virginia Bioinformatics Institute |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 23922628 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Compost Microbial Communities From Sao Paulo Zoo, Brazil |
Type | Engineered |
Taxonomy | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Sao Paulo Zoo, Brazil | |||||||
Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105419 | Metagenome / Metatranscriptome | 100 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
ZC4mRNADay03_133204 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 520 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
ZC4mRNADay03_133204 | ZC4mRNADay03_1332041 | F105419 | VRKFIALSALLVAAAAANGCISTTMYGCEITETLAPGASEGEVIMKHGAPDNIVYLGTQYFNPQTGERGEVDKYLYEYRIGGGNTLLGQVFASDEFHNICYLIEGGRVMGGGYVGEGKGSIILGNDFGVLNTPLGSIDLRFGGFLHPKARAGYGGDG |
⦗Top⦘ |