| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003467 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110185 | Gp0103952 | Ga0059326 |
| Sample Name | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Campinas |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 302503132 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → mine drainage → contaminated soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mina do Sossego, Brazil | |||||||
| Coordinates | Lat. (o) | -6.426389 | Long. (o) | -50.051389 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090029 | Metagenome / Metatranscriptome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| P22013CM_10003406 | Not Available | 1191 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| P22013CM_10003406 | P22013CM_100034062 | F090029 | MVTMRRFLEAEGGISPQEFVDRAAQVLGLQPPSKLEVKPEASVWRFLDLCLFALMKTNGTGYVENAMTRATGVCCQSFAKATMQCFQCPYRSAEIPTLRRFYQDAKQKAQILEKQMEGAE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |