NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003452

3300003452: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S10-DC09A



Overview

Basic Information
IMG/M Taxon OID3300003452 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111425 | Gp0104223 | Ga0059308
Sample NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S10-DC09A
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size40278036
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine neritic zonemarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021303Metagenome / Metatranscriptome219Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
DC09A_1489015All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium508Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
DC09A_1489015DC09A_14890151F021303MSDQPVSTDVLSLQANVLDHSSEFVELVYREAPAEYQRLMVSERFRRELGQDNSFNHGKLFAYAEFAVFRREFRKRFPGASPVACTNAFCRLLLKNDISITNLVDFVEGPD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.