Basic Information | |
---|---|
IMG/M Taxon OID | 3300003364 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103000 | Gp0061307 | Ga0006271 |
Sample Name | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/21 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 81327445 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → borehole → clay soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Mt. Terri, Switzerland | |||||||
Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041155 | Metagenome | 160 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI25320J50211_1019290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 568 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI25320J50211_1019290 | JGI25320J50211_10192901 | F041155 | HWQKIVGCAINVGAESVEVGVHRGLRVDGVLDTADFGLSASFSLDSMVNPVESII* |
⦗Top⦘ |