NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003341

3300003341: Upper troposphere microbial communities from Midwestern USA - DC3-114



Overview

Basic Information
IMG/M Taxon OID3300003341 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110167 | Gp0085206 | Ga0007652
Sample NameUpper troposphere microbial communities from Midwestern USA - DC3-114
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6427481
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationMidwestern USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045749Metagenome / Metatranscriptome152Y
F054846Metagenome / Metatranscriptome139N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25841J50177_100290Not Available667Open in IMG/M
JGI25841J50177_100378Not Available612Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25841J50177_100290JGI25841J50177_1002901F054846LGDNSQSAINEKMPRRGAEGRGQGRESRKSLSEHDTSRKPERVPMYQQRTMIDTTLIPEGFHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDPDFFSRDENGRDTPASRGIGRVTTNDFVL*
JGI25841J50177_100378JGI25841J50177_1003781F045749ESELFDYFGGRDEAGEYFENLFRESELHAGAIKTFILNHTISEDFKPSGRAPDTVSRRLMIQASVSPEQSLVEDLINKHECGVVNGRILDVTWFKSLCXGEGDVLPQSRTLAHILNDXGYQQITGRRXKIKKTRENHYIWFKAKKGVDEESVKNEVQDFFGNDLDQVPF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.