NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003307

3300003307: Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only)



Overview

Basic Information
IMG/M Taxon OID3300003307 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0061252 | Ga0006883
Sample NameHypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size107170253
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica1
All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera1
Not Available1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Zoopagomycota → Entomophthoromycotina → Entomophthoromycetes → Entomophthorales → Ancylistaceae → Conidiobolus → Conidiobolus coronatus → Conidiobolus coronatus NRRL 286381

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springmicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.7999Long. (o)-121.7999Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y
F004248Metagenome / Metatranscriptome446Y
F006424Metagenome / Metatranscriptome373Y
F007073Metagenome / Metatranscriptome358Y
F015563Metagenome / Metatranscriptome253Y
F082762Metagenome / Metatranscriptome113Y
F098745Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0006883J46559_1017906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15903Open in IMG/M
Ga0006883J46559_1022880All Organisms → cellular organisms → Eukaryota1340Open in IMG/M
Ga0006883J46559_1030446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3730Open in IMG/M
Ga0006883J46559_1036156All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica691Open in IMG/M
Ga0006883J46559_1042081All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera824Open in IMG/M
Ga0006883J46559_1056350All Organisms → cellular organisms → Eukaryota1170Open in IMG/M
Ga0006883J46559_1086141Not Available919Open in IMG/M
Ga0006883J46559_1122268All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Zoopagomycota → Entomophthoromycotina → Entomophthoromycetes → Entomophthorales → Ancylistaceae → Conidiobolus → Conidiobolus coronatus → Conidiobolus coronatus NRRL 28638500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0006883J46559_1017906Ga0006883J46559_10179066F001506MNRILYEIRCKCKENISITKKRKSTSRTEGKRLVYPKSNELTSKSFQIEYEKKLSSVAKCLLNSFQHKYFYYAVDDILYLCKSNAKERENLLAILYSPVILLQNNLFINFFDIWIQEIYITEVLKSNKFLKTTDSNVESFHSITIKLLYRTKTPVKQQESLW*
Ga0006883J46559_1022880Ga0006883J46559_10228801F006424MIGSGRVDTVFIRNDFPEFSSDLVTTLSSLNMYDFSHFQISG
Ga0006883J46559_1030446Ga0006883J46559_10304466F001506MNRVFYQINCRCKKEISLTRKRKSNNRSEGRSFPYPNVDELTSKTFQLKYEKHLSSMAKFVLTSLQKKYFYYAIDDISYLLKSNPIERDNLLTILYSTVLSLHNNFSINFFDIWIHEIHITEVSNHNKFLTNKSQNCKPFYYITIKFLYRTKVPVKKQKSLW*
Ga0006883J46559_1036156Ga0006883J46559_10361562F098745MKKLFAKDKEKRQSVKQKELKHFVLKQISTNANFIKTVRWNALYELNS
Ga0006883J46559_1042081Ga0006883J46559_10420811F015563MSTTSLRTARSATSKVSNKAAFWGQWGANNPKHAETFLKQAYNRGYGQPLITGRYIEYDNTPTFLTFLARRWRYDWLKHIAMRVDAQRTPLVVLRRQIWMARFEYWARRWYARKAINRAAKVEWAFIKAKLEQPFTWTGHDLLHGLFWSMNMFAFFAIGEIFCRDRINGYGVATPEWTPAKPKFAPGFYHVYDPFESYPFDNQTNFITKQFQRTSWWNNSMETYWAPHRILA
Ga0006883J46559_1056350Ga0006883J46559_10563501F082762MLGLFTESLTYLFPGGRTLKLIKNGVSVTNSSNPVVLAKNITLTVVDCCAPPPLRLAAHCIAAGATIAASIAAPNPVTLGSAVHLVTELYE
Ga0006883J46559_1086141Ga0006883J46559_10861411F007073VAVVLLAFIAVALAIDAVGEGNSEAPDQVVNPPNWHGTWTANNRYGGVMYACPQGNRLYGVYSNAGFFIGRFEGRSVVGNWWEGGRGDRNDWQGSFEITISPDNQEFDGFYHRVTQDGTELRWHEHRLGAPYPSNPTPAQCLVPADEPVLGSFFRRPTGSATPAQYDLCKDEYDQIYGSYQSPQGYIEGWSVDSSTGFHGYRYDSNGESGAYILRSISDSEVRGFYWRGRLARQNIATSTEEILDRSSFVTTLDACQSVGPGFLRRLRGPQKGSAATLSISLFTIAAALLFVLF*
Ga0006883J46559_1122268Ga0006883J46559_11222681F004248GTSDTYHEDKILNKYLSLDSEGKELVYKAAVQLAIIGYGSKNYGFVRKNEDEIVNLTDIFKKYGIKYLEKLNSKYNEDDLSVRRLLRLFRYQISRFIIENQRPSYLWLKYSNKNKNFIHICFPGGEHMVENKEEAEYLISTYSNLDVQLGTKFRDRLRRVFIARNI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.