| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003282 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111422 | Gp0103916 | Ga0057658 |
| Sample Name | Enhanced biological phosphorus removal bioreactor microbial communities from the University of Queensland, Australia- Sample FLOC |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Australian Centre for Ecogenomics |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 44400269 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Thorneside, Queensland, Australia | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | 153.190699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054974 | Metagenome | 139 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| KU72_1001060 | KU72_100106028 | F054974 | MTTRQLGWSRLIVGLVLVLIAALMFLLPDATYSTAGAVAIGVLGLISIAI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |