Basic Information | |
---|---|
IMG/M Taxon OID | 3300003254 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111459 | Gp0103159 | Ga0057484 |
Sample Name | Marine sponge Petrosia ficiformis associated microbial communities from Achziv, Israel - Sample 106 |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 58315382 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel |
Type | Host-Associated |
Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge Petrosia Ficiformis Associated → Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Achziv, Israel | |||||||
Coordinates | Lat. (o) | 33.01 | Long. (o) | 35.04 | Alt. (m) | N/A | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055778 | Metagenome / Metatranscriptome | 138 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Pfc106_1000033 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 41363 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Pfc106_1000033 | Pfc106_100003321 | F055778 | MLSNVDFPEPELPTIKTISPCSTERVALSRALTLFSPSP* |
⦗Top⦘ |