| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003170 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085230 | Ga0007676 |
| Sample Name | Upper troposphere microbial communities - SDPR-005 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8155604 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Type | Environmental |
| Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA and various oceans | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016972 | Metagenome / Metatranscriptome | 243 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI25865J46337_100597 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 700 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI25865J46337_100597 | JGI25865J46337_1005971 | F016972 | LYFYIYLTIYDSYRVSFGAKTSRYGPYALGYRRATKTFTI* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |