NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003168

3300003168: Upper troposphere microbial communities from Maryland, USA - DAQMD-024



Overview

Basic Information
IMG/M Taxon OID3300003168 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085193 | Ga0007639
Sample NameUpper troposphere microbial communities from Maryland, USA - DAQMD-024
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21354353
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA: Maryland, Virginia
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025749Metagenome200Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25828J46368_104666Not Available948Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25828J46368_104666JGI25828J46368_1046661F025749MTTQMTMRDIRRVLFETEKYTVIGSDEMTNKESRDFLYVKDNQDEVMNVIDNNSHLLIWG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.