


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003155 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111493 | Gp0097869 | Ga0052270 |
| Sample Name | Broiler Chicken cecum microbial communities from the University of Birmingham, UK |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Birmingham |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 286286924 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Birds → Digestive System → Ceca → Lumen → Broiler Chicken Cecum → Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | University of Birmingham, UK | |||||||
| Coordinates | Lat. (o) | 50.9047 | Long. (o) | -3.5233 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052270_10308069 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 3072 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052270_10308069 | Ga0052270_103080694 | F051936 | MKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK* |
| ⦗Top⦘ |