Sample 3300003151

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003151

3300003151: Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent

Overview

Basic Information
IMG/M Taxon OID	3300003151 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0055713 \| Gp0052075 \| Ga0051092
Sample Name	Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent
Sequencing Status	Finished
Sequencing Center	SymBio Corporation
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	147567453
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent
Type	Host-Associated
Taxonomy	Host-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont → Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal surface

Location Information
Location	East Pacific Rise
Coordinates	Lat. (^o)	9.8344	Long. (^o)	-104.2844	Alt. (m)	N/A	Depth (m)	2500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088984	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0051092_1000525	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4484	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051092_1000525	Ga0051092_10005259	F088984	MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.