Basic Information | |
---|---|
IMG/M Taxon OID | 3300003151 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055713 | Gp0052075 | Ga0051092 |
Sample Name | Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent |
Sequencing Status | Finished |
Sequencing Center | SymBio Corporation |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 147567453 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent |
Type | Host-Associated |
Taxonomy | Host-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont → Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | East Pacific Rise | |||||||
Coordinates | Lat. (o) | 9.8344 | Long. (o) | -104.2844 | Alt. (m) | N/A | Depth (m) | 2500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088984 | Metagenome / Metatranscriptome | 109 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0051092_1000525 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4484 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0051092_1000525 | Ga0051092_10005259 | F088984 | MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV* |
⦗Top⦘ |