Sample 3300003138

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003138

3300003138: Sediment microbial communities from subsurface aquifer at Rifle, CO - flow-through sediment column

Overview

Basic Information
IMG/M Taxon OID	3300003138 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111418 \| Gp0097814 \| Ga0052259
Sample Name	Sediment microbial communities from subsurface aquifer at Rifle, CO - flow-through sediment column
Sequencing Status	Permanent Draft
Sequencing Center	University of California, Berkeley
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	32714692
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment → Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater biome → aquifer → sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline)

Location Information
Location	USA: Rifle, CO
Coordinates	Lat. (^o)	39.529053	Long. (^o)	-107.772406	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0052259_1012231	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3825	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0052259_1012231	Ga0052259_10122313	F017253	MLKSVFLLTANVGSYMQVRIAGDFLSSRKAAWAERCTPKTTAAALDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.