| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003123 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111447 | Gp0097434 | Ga0052188 |
| Sample Name | Hypersaline anoxic lake microbial communities from Lake Thetis, Australia |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 13096959 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hypersaline lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Thetis, Australia | |||||||
| Coordinates | Lat. (o) | -30.506732 | Long. (o) | 115.081428 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056324 | Metagenome / Metatranscriptome | 137 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052188_101108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2296 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052188_101108 | Ga0052188_1011084 | F056324 | MKGKLVITLMVLTLIAGLSGCAGSKIYLIDVKYLAEKKLPPTLKVVGVCTFEDARKGRGGDTIGVRHRPGKHVDLLKLEEVNLSEVTTQAVKDYFTDNGFQVTDCKGWNMSPEGLDRLPKDLSLVVGGKIDSFMVEAKSGITTTTDIQYIVKIEALIGQMEDRKVIIRTRKSASKSKEMGFDPGKVKDELNSILTEVIQNLFK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |