NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003123

3300003123: Hypersaline anoxic lake microbial communities from Lake Thetis, Australia



Overview

Basic Information
IMG/M Taxon OID3300003123 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111447 | Gp0097434 | Ga0052188
Sample NameHypersaline anoxic lake microbial communities from Lake Thetis, Australia
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13096959
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehypersaline lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationLake Thetis, Australia
CoordinatesLat. (o)-30.506732Long. (o)115.081428Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056324Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0052188_101108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2296Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0052188_101108Ga0052188_1011084F056324MKGKLVITLMVLTLIAGLSGCAGSKIYLIDVKYLAEKKLPPTLKVVGVCTFEDARKGRGGDTIGVRHRPGKHVDLLKLEEVNLSEVTTQAVKDYFTDNGFQVTDCKGWNMSPEGLDRLPKDLSLVVGGKIDSFMVEAKSGITTTTDIQYIVKIEALIGQMEDRKVIIRTRKSASKSKEMGFDPGKVKDELNSILTEVIQNLFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.