| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003115 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111449 | Gp0097859 | Ga0052267 |
| Sample Name | Acid mine drainage microbial communities from Los Rueldos abandoned mercury mine in Spain - Sample B2A |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute of Catalysis, The Higher Council for Scientific Research (CSIC) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 10850070 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → acid mine drainage → acidic water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mogao stream, Los Rueldos, Spain | |||||||
| Coordinates | Lat. (o) | 43.25 | Long. (o) | -5.7666667 | Alt. (m) | N/A | Depth (m) | .03 to .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063194 | Metagenome / Metatranscriptome | 130 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052267_104590 | Not Available | 939 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052267_104590 | Ga0052267_1045901 | F063194 | SLTQQYASLNVLLSQLQTTSSYLTQAFAALPNAPKGTSSGG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |