NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003105

3300003105: Fresh water viral communities from Lake Needwood, MD



Overview

Basic Information
IMG/M Taxon OID3300003105 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063260 | Gp0052157 | Ga0051101
Sample NameFresh water viral communities from Lake Needwood, MD
Sequencing StatusFinished
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3617333
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFresh Water Viral Communities From Lake Needwood, Md
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLake Needwood, Maryland, USA
CoordinatesLat. (o)39.121Long. (o)-77.129Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002343Metagenome / Metatranscriptome568Y
F032996Metagenome178Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0051101_100241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2549Open in IMG/M
Ga0051101_113333Not Available669Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0051101_100241Ga0051101_1002415F032996MINEKTKGGSGKTYSVFEITSKTTGRKHFMVSSRYTLENILSGIRTYVDSKTVGGGAKELAQDIYNAGKNYEEDFTVKEVGKGMSREIAERRRAELVTKSGEVYNQEIGVT*
Ga0051101_113333Ga0051101_1133333F002343VGDAVNEIDLKVTLEEAVGIVNLLGSLPTAQGAHPLWLKLKAQVEPLIPKPDEVQQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.