| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003098 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111433 | Gp0097853 | Ga0052264 |
| Sample Name | Marine microbial communities from surface seawater at Gulf of Maine |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5278992 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Surface Seawater At Gulf Of Maine |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater At Gulf Of Maine |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine photic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Maine | |||||||
| Coordinates | Lat. (o) | 43.14 | Long. (o) | -68.33 | Alt. (m) | N/A | Depth (m) | 1.5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055778 | Metagenome / Metatranscriptome | 138 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052264_102069 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 30546 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052264_102069 | Ga0052264_10206924 | F055778 | MFSNVDFPEPDAPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |