| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003092 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0061992 | Gp0051686 | Ga0051078 |
| Sample Name | Hot spring microbial communities from Five Geothermal Springs in Yellowstone National Park, USA - Joseph's Coat Hot Spring-Scorodite Spring |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3876971 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Joseph's Coat Hot Spring and Scorodite Spring, Yellowstone National Park, USA | |||||||
| Coordinates | Lat. (o) | 44.969421 | Long. (o) | -110.690383 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105516 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0051078_101069 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | 1226 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0051078_101069 | Ga0051078_1010693 | F105516 | MPRAIVRVLALGRVSLNLKTFRVTASERLSVDSDGTVNCLGGDCSANGTFITLETEHPNPRELYDALKKVRVLELEVEIHGLPNWLLSRLEFLVGKPTSDKVRYTWHKMPSFGELALVLNDLNLNA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |