x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300003084
3300003084: Marine pico-prymnesiophytes microbial communities from Florida Straits, Gulf of Mexico, Atlantic Ocean
Overview
| Basic Information |
| IMG/M Taxon OID | 3300003084 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046702 | Gp0052162 | Ga0051102 |
| Sample Name | Marine pico-prymnesiophytes microbial communities from Florida Straits, Gulf of Mexico, Atlantic Ocean |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 2590812 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Marine Pico-Prymnesiophytes Phytoplankton Communities From Florida Straits, Gulf Of Mexico, Atlantic Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Pico-Prymnesiophytes → Marine Pico-Prymnesiophytes Phytoplankton Communities From Florida Straits, Gulf Of Mexico, Atlantic Ocean |
| Location Information |
| Location | Florida Straits, Gulf of Mexico, Atlantic Ocean |
| Coordinates | Lat. (o) | 23.359462 | Long. (o) | -82.379192 | Alt. (m) | N/A | Depth (m) | 75 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F024700 | Metagenome / Metatranscriptome | 204 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0051102_10899 | All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi | 5083 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0051102_10899 | Ga0051102_108993 | F024700 | MPKGPAKATGLYAEMDLTGVVSTLESHWVVLDAELSEIRKDFASLRTLTRKHGDFWSRPMAQLKKLRTQKENLLKEIKFQMELFNLHIQQGRDLCSKLSSVASVIKTPPAQLQSQLAIEVVSPILANSQNPLSVAREPL* |