NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002974

3300002974: Subsurface hydrocarbon microbial communities from various worldwide Shell locations



Overview

Basic Information
IMG/M Taxon OID3300002974 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
| |
Sample NameSubsurface hydrocarbon microbial communities from various worldwide Shell locations
Sequencing StatusComplete
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2592275199
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameOil Reservoir
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Reservoir

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationRed Deer, Alberta, Canada
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
GW671_101085GW671_1010851F077438VEPSFRQSRFESLFLWNLQVEISSALRPKAEKEISSYKN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.