Basic Information | |
---|---|
IMG/M Taxon OID | 3300002974 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | | | |
Sample Name | Subsurface hydrocarbon microbial communities from various worldwide Shell locations |
Sequencing Status | Complete |
Sequencing Center | Shell Corporation |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 2592275199 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Oil Reservoir |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Reservoir |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Red Deer, Alberta, Canada | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077438 | Metagenome / Metatranscriptome | 117 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
GW671_101085 | GW671_1010851 | F077438 | VEPSFRQSRFESLFLWNLQVEISSALRPKAEKEISSYKN* |
⦗Top⦘ |