| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002974 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | | | |
| Sample Name | Subsurface hydrocarbon microbial communities from various worldwide Shell locations |
| Sequencing Status | Complete |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2592275199 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Oil Reservoir |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Reservoir |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Red Deer, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| GW671_101085 | GW671_1010851 | F077438 | VEPSFRQSRFESLFLWNLQVEISSALRPKAEKEISSYKN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |