Sample 3300002921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002921

3300002921: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8

Overview

Basic Information
IMG/M Taxon OID	3300002921 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0103015 \| Gp0097840 \| Ga0052838
Sample Name	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8
Sequencing Status	Permanent Draft
Sequencing Center
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	1045660305
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Bare Island, Sydney, Australia
Coordinates	Lat. (^o)	-33.59	Long. (^o)	151.13	Alt. (m)	N/A	Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009040	Metagenome / Metatranscriptome	324	Y
F046726	Metagenome / Metatranscriptome	151	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BIH8_10012724	Not Available	1912	Open in IMG/M
BIH8_10145544	Not Available	641	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BIH8_10012724	BIH8_100127242	F009040	LSGIDPKPPQAAVVKSDGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV*
BIH8_10145544	BIH8_101455441	F046726	LRTIPEQERIEIIQKEFQLQAESLTTCFASKISLKKYYETTDQNSLFQFKGYNIKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.