NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002921

3300002921: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8



Overview

Basic Information
IMG/M Taxon OID3300002921 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0103015 | Gp0097840 | Ga0052838
Sample NameDelisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size1045660305
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDelisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
TypeHost-Associated
TaxonomyHost-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBare Island, Sydney, Australia
CoordinatesLat. (o)-33.59Long. (o)151.13Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009040Metagenome / Metatranscriptome324Y
F046726Metagenome / Metatranscriptome151Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BIH8_10012724Not Available1912Open in IMG/M
BIH8_10145544Not Available641Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BIH8_10012724BIH8_100127242F009040LSGIDPKPPQAAVVKSDGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV*
BIH8_10145544BIH8_101455441F046726LRTIPEQERIEIIQKEFQLQAESLTTCFASKISLKKYYETTDQNSLFQFKGYNIKY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.