| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002879 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111363 | Gp0094530 | Ga0048156 |
| Sample Name | Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Harvard University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 34354668 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Harvard School of Public Health, Boston, MA | |||||||
| Coordinates | Lat. (o) | 42.335579 | Long. (o) | -71.102733 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059106 | Metagenome | 134 | N |
| F074964 | Metagenome | 119 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| HEA_1008745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | 819 | Open in IMG/M |
| HEA_1012533 | Not Available | 682 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| HEA_1008745 | HEA_10087451 | F074964 | MITKKNVNKLQNAVIKESASNLVGAVKLYNALFANGADLKAICKTLEIPAEYAIRVATLAKDKKRLVAVCSQMLPKVGDTFVKFSLYSKVYKDNKVDKEKGIEAKTADWCAENVIYGGEYKSFGFSTAETLETKKSAKWLVKETDEYKATYVAVKIKSYSIRTIAKCVSEYLTHESNQQ* |
| HEA_1012533 | HEA_10125332 | F059106 | MHAIVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |