NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002831

3300002831: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-11



Overview

Basic Information
IMG/M Taxon OID3300002831 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072050 | Ga0007175
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-11
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size178549
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetoglobus → Candidatus Magnetoglobus multicellularis → Candidatus Magnetoglobus multicellularis str. Araruama1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007536Metagenome / Metatranscriptome349Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25434J40558_1007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetoglobus → Candidatus Magnetoglobus multicellularis → Candidatus Magnetoglobus multicellularis str. Araruama869Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25434J40558_1007JGI25434J40558_10071F007536MRLAMDMLNLHLRLIRSALGQKAGAKPMGLPHRERSQGRAAMHGHEVASLPGEMGPPLGQSHERASPFLAKFGLSASLTTGRDAAHAVSGAPMALVLPATTSCIQYVRFTDEVPRRLVPVGRVNPGYKSHTKSRGHASETGTAFPRPRLKGCQQRQSRGARLRLAEGACSERQNLRVLLGPLGFMGPVSPTNAATKWRDGTSSRQLAGLLSNSPQQPKPGQAAVRSR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.